PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.078800.1
Common NameCsa_7G329330, LOC101205805
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family ARF
Protein Properties Length: 695aa    MW: 77953 Da    PI: 6.09
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.078800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.6e-24125226199
                     EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsef 90 
                     f+k+lt sd++++g +++ +k+a+e+     +++++ +++l  +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF   + +++
  Cucsa.078800.1 125 FCKILTASDTSTHGGFSVLRKHATEClppldMSQSTPTQELAAKDLHGYEWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFL--RGDNG 217
                     99****************************9555555669************************************************..34899 PP

                     ..EEEEE-S CS
              B3  91 elvvkvfrk 99 
                     el+v+v+r+
  Cucsa.078800.1 218 ELRVGVRRQ 226
                     99****996 PP

2Auxin_resp100.91.7e-33251330183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr+  s+F+++++k+++++k+ + vGmRfkm+fe+e+s+err++Gt+vgv d++p +W++SkWrsLk
  Cucsa.078800.1 251 ASHAVRTQTYFVVYYKPRT--SQFIISLNKYLETVKNGYEVGMRFKMRFEGEESPERRFTGTIVGVGDMSP-QWSDSKWRSLK 330
                     689***************6..9*************************************************.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.26E-40116254IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.104.0E-40118240IPR015300DNA-binding pseudobarrel domain
CDDcd100171.14E-19123225No hitNo description
PROSITE profilePS5086312.252125227IPR003340B3 DNA binding domain
PfamPF023628.5E-22125226IPR003340B3 DNA binding domain
SMARTSM010192.2E-22125227IPR003340B3 DNA binding domain
PfamPF065074.4E-31251330IPR010525Auxin response factor
SuperFamilySSF542773.92E-11576660No hitNo description
PfamPF023093.0E-5581620IPR033389AUX/IAA domain
PROSITE profilePS5174524.946584676IPR000270PB1 domain
PfamPF023091.1E-5626668IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009734Biological Processauxin-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 695 aa     Download sequence    Send to blast
MTLYEENPGE SRKGLEGEDL YEELWKACAG PLVEVPVDGE RVFYFPQGHM EQLEESTNQE  60
LNHQIPHFDL PPKILCRVVN IRLLAEKETD EVYAQITLYP EADQSEPQSA DPEPPERTRQ  120
TVHSFCKILT ASDTSTHGGF SVLRKHATEC LPPLDMSQST PTQELAAKDL HGYEWKFKHI  180
FRGQPRRHLL TTGWSTFVTS KRLVAGDAFV FLRGDNGELR VGVRRQARQQ SLMPSSVISS  240
HSMHLGVLAT ASHAVRTQTY FVVYYKPRTS QFIISLNKYL ETVKNGYEVG MRFKMRFEGE  300
ESPERRFTGT IVGVGDMSPQ WSDSKWRSLK IQWDEPATIQ RPERVSPWEI EPFVPSASLN  360
FTHPAIKSKR ARPVEIPPPE VTSGSAPSGF WLQGSTISHE ISQLSGTNEV QSSNNRVVWA  420
LGQRKLDSNS SHCNPVANVE GIWPSPPLNI SLNLYPDSTF ERELVQQKHP LSSPYSSSVT  480
SKPSSDLIQP DQLEKGSKPD ISLGCRIFGI DLKNNCSIVP TLERRSSCLM MVTDGAKEPV  540
VTAVVTPQVD AGNLSQPSKE QQLSTELLTK GTQTKHISNL SSRTRTKKVQ MQGVAVGRAV  600
DLTTLEGYED LIDELENVFE IKGELRGINK WSIVFTDDEN DMMLVGDDPW PEFCKMVKRI  660
FICSSEEVKK MSRESKIVSP SSLDSLDSER KTES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1721435313355Auxin response factor 1
4ldw_A1e-1721435313355Auxin response factor 1
4ldw_B1e-1721435313355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKU3234110.0KU323411.1 UNVERIFIED: Trichosanthes dioica clone TdARF_9 auxin response factor 18-like mRNA, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004139643.10.0PREDICTED: auxin response factor 18 isoform X1
SwissprotQ9C5W90.0ARFR_ARATH; Auxin response factor 18
TrEMBLA0A0A0K8870.0A0A0A0K887_CUCSA; Auxin response factor
STRINGVIT_15s0046g00290.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15113396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.20.0auxin response factor 9
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]